Atlas Antibodies Anti-BTLA Antibody

상품 한눈에 보기

Human BTLA 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. BTLA1, CD272 대체 유전자명. 고순도 Affinity 정제 및 PBS/glycerol buffer 보존. 다양한 조직에서 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체.

카탈로그번호: HPA062029-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062029-100 Anti-BTLA Antibody, B and T lymphocyte associated 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062029-25 Anti-BTLA Antibody, B and T lymphocyte associated 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-BTLA Antibody

Anti-BTLA Antibody

B and T lymphocyte associated

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human BTLA

Alternative Gene Names

BTLA1, CD272

Open Datasheet

Target Information

항목	내용
Target Protein	B and T lymphocyte associated
Target Gene	BTLA
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	ETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPTE