CacheBy
Atlas Antibodies Anti-BSPRY Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BSPRY Antibody

상품 한눈에 보기

Human BSPRY 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Mouse 및 Rat과도 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA077485-100 Anti-BSPRY Antibody, B-box and SPRY domain containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077485-25 Anti-BSPRY Antibody, B-box and SPRY domain containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BSPRY Antibody

Anti-BSPRY Antibody

Product Description

Polyclonal antibody against Human BSPRY (B-box and SPRY domain containing) protein.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Alternative Gene Names

  • FLJ20150

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein B-box and SPRY domain containing
Target Gene BSPRY
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NSCAYKVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDLQVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000028392 (82%), Rat ENSRNOG00000015105 (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.