AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BSPRY Antibody
상품 한눈에 보기
Human BSPRY 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Mouse 및 Rat과도 높은 서열 유사성을 가집니다.
- 카탈로그번호
- HPA077485-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA077485-100 Anti-BSPRY Antibody, B-box and SPRY domain containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077485-25 Anti-BSPRY Antibody, B-box and SPRY domain containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BSPRY Antibody
Anti-BSPRY Antibody
Product Description
Polyclonal antibody against Human BSPRY (B-box and SPRY domain containing) protein.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Alternative Gene Names
- FLJ20150
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | B-box and SPRY domain containing |
| Target Gene | BSPRY |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NSCAYKVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDLQVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000028392 (82%), Rat ENSRNOG00000015105 (81%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.