CacheBy
Atlas Antibodies Anti-BSPH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BSPH1 Antibody

상품 한눈에 보기

Human BSPH1 단백질에 특이적인 폴리클로날 항체로, IHC 기반 정량 분석에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현을 비교 검증. Rabbit 유래 IgG로 PrEST 항원으로 정제됨. 40% glycerol 기반 PBS buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA048335-100 Anti-BSPH1 Antibody, binder of sperm protein homolog 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048335-25 Anti-BSPH1 Antibody, binder of sperm protein homolog 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BSPH1 Antibody

Anti-BSPH1 Antibody

Target: binder of sperm protein homolog 1 (BSPH1)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human BSPH1.


Alternative Gene Names

BSP1, ELSPBP2

Open Datasheet


Target Information

항목 내용
Target Protein binder of sperm protein homolog 1
Target Gene BSPH1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTY

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000052287 (43%)
  • Mouse ENSMUSG00000074378 (42%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.