
Atlas Antibodies Anti-BPGM Antibody
상품 한눈에 보기
인간 BPGM 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 직교 검증 완료. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성을 보장.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BPGM Antibody
Target: 2,3-bisphosphoglycerate mutase (BPGM)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression levels.
- WB (Western Blot): Suitable for detection of BPGM protein.
Product Description
Polyclonal antibody against human BPGM.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | 2,3-bisphosphoglycerate mutase |
| Target Gene | BPGM |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQA |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000038871 (93%), Rat ENSRNOG00000010133 (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BPGM Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BORCS7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BPGM Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BORCS8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BORCS6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.