CacheBy
Atlas Antibodies Anti-BPGM Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BPGM Antibody

상품 한눈에 보기

인간 BPGM 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 직교 검증 완료. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성을 보장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA028735-100 Anti-BPGM Antibody, 2,3-bisphosphoglycerate mutase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028735-25 Anti-BPGM Antibody, 2,3-bisphosphoglycerate mutase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BPGM Antibody

Anti-BPGM Antibody

Target: 2,3-bisphosphoglycerate mutase (BPGM)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression levels.
  • WB (Western Blot): Suitable for detection of BPGM protein.

Product Description

Polyclonal antibody against human BPGM.

Open Datasheet


Target Information

항목 내용
Target Protein 2,3-bisphosphoglycerate mutase
Target Gene BPGM
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQA

Species Reactivity

항목 내용
Verified Species Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000038871 (93%), Rat ENSRNOG00000010133 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.