Atlas Antibodies Anti-BORCS6 Antibody

상품 한눈에 보기

인간 BORCS6 단백질을 대상으로 한 폴리클로나 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. 인간과 높은 서열 유사성을 가진 마우스 및 랫트에서도 반응성이 확인되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA060791-100 Anti-BORCS6 Antibody, BLOC-1 related complex subunit 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA060791-25 Anti-BORCS6 Antibody, BLOC-1 related complex subunit 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: BLOC-1 related complex subunit 6 (BORCS6)
Supplier: Atlas Antibodies

Polyclonal antibody against human BORCS6.

항목	내용
Target Protein	BLOC-1 related complex subunit 6
Target Gene	BORCS6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (98%), Rat (96%)

Antigen Sequence:
PTPAIPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELE

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand