Atlas Antibodies Anti-BOC Antibody

상품 한눈에 보기

인간 BOC 단백질을 인식하는 폴리클로날 항체로, 세포 접착 관련 온코진 조절 단백질 연구에 적합합니다. 토끼 유래 IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증되었으며, 면역세포화학 등 다양한 응용에 사용 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061787-100 Anti-BOC Antibody, BOC cell adhesion associated, oncogene regulated 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061787-25 Anti-BOC Antibody, BOC cell adhesion associated, oncogene regulated 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: BOC cell adhesion associated, oncogene regulated
Supplier: Atlas Antibodies

Polyclonal antibody against Human BOC.

항목	내용
Target Protein	BOC cell adhesion associated, oncogene regulated
Target Gene	BOC
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	KHTTDLGFPRSALPPSCPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGELQQQSDTSSLL

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)