
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BOC Antibody
상품 한눈에 보기
Human BOC 단백질을 인식하는 Rabbit Polyclonal Antibody로, 세포 부착 관련 온코진 조절 단백질 연구에 적합. IgG 아이소타입이며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성 검증 완료.
- 카탈로그번호
- HPA060778-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA060778-100 Anti-BOC Antibody, BOC cell adhesion associated, oncogene regulated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060778-25 Anti-BOC Antibody, BOC cell adhesion associated, oncogene regulated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BOC Antibody
Anti-BOC Antibody
BOC cell adhesion associated, oncogene regulated 단백질을 표적으로 하는 항체입니다.
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
- Polyclonal Antibody against Human BOC
Alternative Gene Names
- CDON2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | BOC cell adhesion associated, oncogene regulated |
| Target Gene | BOC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KHTTDLGFPRSALPPSCPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGELQQQSDTSSLL |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000022687 | 74% |
| Rat | ENSRNOG00000002041 | 74% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 충분히 혼합하십시오.
- 각 응용 분야에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



