CacheBy
Atlas Antibodies Anti-BOC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BOC Antibody

상품 한눈에 보기

Human BOC 단백질을 인식하는 Rabbit Polyclonal Antibody로, 세포 부착 관련 온코진 조절 단백질 연구에 적합. IgG 아이소타입이며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA060778-100 Anti-BOC Antibody, BOC cell adhesion associated, oncogene regulated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060778-25 Anti-BOC Antibody, BOC cell adhesion associated, oncogene regulated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BOC Antibody

Anti-BOC Antibody

BOC cell adhesion associated, oncogene regulated 단백질을 표적으로 하는 항체입니다.

  • Immunocytochemistry (ICC)

Product Description

  • Polyclonal Antibody against Human BOC

Alternative Gene Names

  • CDON2

Open Datasheet

Target Information

항목 내용
Target Protein BOC cell adhesion associated, oncogene regulated
Target Gene BOC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KHTTDLGFPRSALPPSCPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGELQQQSDTSSLL

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 동일성
Mouse ENSMUSG00000022687 74%
Rat ENSRNOG00000002041 74%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 충분히 혼합하십시오.
  • 각 응용 분야에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.