
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BIRC5 Antibody
상품 한눈에 보기
Human BIRC5 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 Recombinant Expression Validation을 통해 신뢰성 높은 단백질 발현 분석에 적합. Rabbit 유래 IgG 항체로 PrEST 항원 기반 친화 정제됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA002830-100 Anti-BIRC5 Antibody, baculoviral IAP repeat containing 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002830-25 Anti-BIRC5 Antibody, baculoviral IAP repeat containing 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BIRC5 Antibody
Anti-BIRC5 Antibody
Target: baculoviral IAP repeat containing 5 (BIRC5)
Supplier: Atlas Antibodies
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human BIRC5
Alternative Gene Names
API4, EPR-1, survivin
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | baculoviral IAP repeat containing 5 |
| Target Gene | BIRC5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000050819 (88%), Mouse ENSMUSG00000017716 (86%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



