Atlas Antibodies Anti-BIRC5 Antibody
상품 한눈에 보기
Human BIRC5 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 Recombinant Expression Validation을 통해 신뢰성 높은 단백질 발현 분석에 적합. Rabbit 유래 IgG 항체로 PrEST 항원 기반 친화 정제됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BIRC5 Antibody
Target: baculoviral IAP repeat containing 5 (BIRC5)
Supplier: Atlas Antibodies
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human BIRC5
Alternative Gene Names
API4, EPR-1, survivin
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | baculoviral IAP repeat containing 5 |
| Target Gene | BIRC5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000050819 (88%), Mouse ENSMUSG00000017716 (86%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.