CacheBy
Atlas Antibodies Anti-BIRC5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BIRC5 Antibody

상품 한눈에 보기

Human BIRC5 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 Recombinant Expression Validation을 통해 신뢰성 높은 단백질 발현 분석에 적합. Rabbit 유래 IgG 항체로 PrEST 항원 기반 친화 정제됨.

카탈로그번호
HPA002830-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002830-100 Anti-BIRC5 Antibody, baculoviral IAP repeat containing 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002830-25 Anti-BIRC5 Antibody, baculoviral IAP repeat containing 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BIRC5 Antibody

Anti-BIRC5 Antibody

Target: baculoviral IAP repeat containing 5 (BIRC5)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Recombinant Expression Validation
    Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human BIRC5


Alternative Gene Names

API4, EPR-1, survivin

Open Datasheet


Specifications

항목 내용
Target Protein baculoviral IAP repeat containing 5
Target Gene BIRC5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000050819 (88%), Mouse ENSMUSG00000017716 (86%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Recombinant Validation
Recombinant Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.