CacheBy
Atlas Antibodies Anti-BIRC7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BIRC7 Antibody

상품 한눈에 보기

인간 BIRC7 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. PrEST 항원으로 친화 정제되었으며 ICC 등 다양한 응용에 적합합니다. Human에 반응성이 검증되었고 보존액으로 glycerol 및 PBS를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA047850-100 Anti-BIRC7 Antibody, baculoviral IAP repeat containing 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047850-25 Anti-BIRC7 Antibody, baculoviral IAP repeat containing 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BIRC7 Antibody

Anti-BIRC7 Antibody

Target: baculoviral IAP repeat containing 7 (BIRC7)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human BIRC7.


Alternative Gene Names

KIAP, ML-IAP, mliap, RNF50

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein baculoviral IAP repeat containing 7
Target Gene BIRC7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000038840 (51%), Rat ENSRNOG00000043311 (48%)

Antigen Sequence:
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.