
Atlas Antibodies Anti-PCDHB6 Antibody
상품 한눈에 보기
Human PCDHB6 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며, 보존용으로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PCDHB6 Antibody
Target Information
- Target Protein: protocadherin beta 6
- Target Gene: PCDHB6
- Alternative Gene Names: PCDH-BETA6
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human PCDHB6
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
QVPENNPLGSLVITVSARDLDAGSFGKVSYALFQVDDVNQPFEINAITGEIRLRKALDFEEIQSYDVDVEATDGGGLSGKCSLVVRVLDVNDNAPELTMSFFISLIPENLPEITVAVFSVSDADS
Species Reactivity
- Verified Species Reactivity: Human
- Interspecies Information:
- Mouse ENSMUSG00000047307 (77%)
- Rat ENSRNOG00000020062 (73%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- Composition: 40% glycerol and PBS (pH 7.2)
- Preservative: 0.02% sodium azide
- Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PCDHGA10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCDHB5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCDHB6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCDHB6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCDHB5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.