
1 / 2
Atlas Antibodies Anti-PCDHB5 Antibody
상품 한눈에 보기
인간 PCDHB5 단백질을 인식하는 토끼 유래 폴리클로날 항체. 면역조직화학 등 연구용으로 적합. 고순도 친화정제 방식으로 제조. 인간에 특이적 반응성을 검증함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PCDHB5 Antibody
Target: protocadherin beta 5 (PCDHB5)
Type: Polyclonal Antibody
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human PCDHB5 (protocadherin beta 5).
Alternative Gene Names
- DKFZp586B0217
- PCDH-BETA5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protocadherin beta 5 |
| Target Gene | PCDHB5 |
| Verified Species Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000020073 (82%), Mouse ENSMUSG00000051486 (82%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
HYKGNKELLQLDIKTGNLLLYEKLDREVMCGATEPCILHFQLLLENPVQFFQTDLQLTDINDHAPEFPEKEMLLKIPESTQPGTVFPLKIAQDFDIGSNTVQNY
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PCDHB6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCDHB6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCDHB5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCDHB4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCDHB2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.