Atlas Antibodies Anti-PAPOLB Antibody

상품 한눈에 보기

Human PAPOLB 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 제조된 IgG 형식입니다. poly(A) polymerase beta 단백질 검출에 적합하며, 고순도 Affinity purification 방식으로 제조되었습니다. ICC 등 다양한 응용에 사용 가능합니다.

카탈로그번호: HPA047285-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047285-100 Anti-PAPOLB Antibody, poly(A) polymerase beta 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047285-25 Anti-PAPOLB Antibody, poly(A) polymerase beta 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PAPOLB Antibody

Anti-PAPOLB Antibody

Target Information

Target Protein: poly(A) polymerase beta
Target Gene: PAPOLB
Alternative Gene Names: PAPT

Recommended Applications

이 항체는 Immunocytochemistry (ICC) 등 다양한 실험 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human PAPOLB

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
SLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000074817 (52%)
Rat ENSRNOG00000004827 (42%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.