
Atlas Antibodies Anti-PAPOLB Antibody
상품 한눈에 보기
Human PAPOLB 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 제조된 IgG 형식입니다. poly(A) polymerase beta 단백질 검출에 적합하며, 고순도 Affinity purification 방식으로 제조되었습니다. ICC 등 다양한 응용에 사용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PAPOLB Antibody
Target Information
- Target Protein: poly(A) polymerase beta
- Target Gene: PAPOLB
- Alternative Gene Names: PAPT
Recommended Applications
이 항체는 Immunocytochemistry (ICC) 등 다양한 실험 응용에 적합합니다.
Product Description
Polyclonal Antibody against Human PAPOLB
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
SLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000074817 (52%)
- Rat ENSRNOG00000004827 (42%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Additional Information
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PAPOLA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAPPA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAPOLB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAPOLG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAPD7 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.