CacheBy
Atlas Antibodies Anti-PAPOLB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PAPOLB Antibody

상품 한눈에 보기

Human PAPOLB 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 제조된 IgG 형식입니다. poly(A) polymerase beta 단백질 검출에 적합하며, 고순도 Affinity purification 방식으로 제조되었습니다. ICC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA047285-100 Anti-PAPOLB Antibody, poly(A) polymerase beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047285-25 Anti-PAPOLB Antibody, poly(A) polymerase beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PAPOLB Antibody

Anti-PAPOLB Antibody

Target Information

  • Target Protein: poly(A) polymerase beta
  • Target Gene: PAPOLB
  • Alternative Gene Names: PAPT

이 항체는 Immunocytochemistry (ICC) 등 다양한 실험 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human PAPOLB

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    SLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000074817 (52%)
  • Rat ENSRNOG00000004827 (42%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Additional Information

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.