
1 / 2
Atlas Antibodies Anti-PAPPA2 Antibody
상품 한눈에 보기
Human PAPPA2 단백질에 대한 고품질 폴리클로날 항체. IHC 및 RNA-seq 데이터 비교를 통한 정교한 Orthogonal Validation 제공. Rabbit 호스트 기반 IgG 항체로 고순도 Affinity 정제. 다양한 연구 응용에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PAPPA2 Antibody
Target Protein: pappalysin 2
Product Type: Polyclonal Antibody against Human PAPPA2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Alternative Gene Names
PAPP-A2, PAPPE, PLAC3
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESLGEAGIQKGSAMAATTTTAIFTTLNEPKPETQRRGWAKSRQRRQVWKRRAEDGQGDSGISSHFQPWPKH
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000073530 | 56% |
| Rat | ENSRNOG00000042860 | 54% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PAPPA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAPOLA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAPPA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAPOLB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAPOLG Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.