CacheBy
Atlas Antibodies Anti-PAM16 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PAM16 Antibody

상품 한눈에 보기

Human PAM16 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. Human에 반응성이 검증되었으며, ICC 등 다양한 연구 응용에 적합. 40% glycerol PBS buffer에 보존제로 sodium azide를 포함함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA062721-100 Anti-PAM16 Antibody, presequence translocase-associated motor 16 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062721-25 Anti-PAM16 Antibody, presequence translocase-associated motor 16 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PAM16 Antibody

Anti-PAM16 Antibody

Target: presequence translocase-associated motor 16 homolog (S. cerevisiae)
Type: Polyclonal Antibody against Human PAM16


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human PAM16 protein.


Alternative Gene Names

  • Magmas
  • Tim16
  • TIMM16

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein presequence translocase-associated motor 16 homolog (S. cerevisiae)
Target Gene PAM16
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT

Verified Species Reactivity

  • Human

Interspecies Information

종 Ortholog ID 항원 서열 일치율
Rat ENSRNOG00000004608 94%
Mouse ENSMUSG00000045886 94%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 설명
40% Glycerol Stabilizer
PBS (pH 7.2) Buffer
0.02% Sodium Azide Preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.