Atlas Antibodies Anti-PAM16 Antibody
상품 한눈에 보기
Human PAM16 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. Human에 반응성이 검증되었으며, ICC 등 다양한 연구 응용에 적합. 40% glycerol PBS buffer에 보존제로 sodium azide를 포함함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PAM16 Antibody
Target: presequence translocase-associated motor 16 homolog (S. cerevisiae)
Type: Polyclonal Antibody against Human PAM16
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human PAM16 protein.
Alternative Gene Names
- Magmas
- Tim16
- TIMM16
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | presequence translocase-associated motor 16 homolog (S. cerevisiae) |
| Target Gene | PAM16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 일치율 |
|---|---|---|
| Rat | ENSRNOG00000004608 | 94% |
| Mouse | ENSMUSG00000045886 | 94% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 설명 |
|---|---|
| 40% Glycerol | Stabilizer |
| PBS (pH 7.2) | Buffer |
| 0.02% Sodium Azide | Preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.