CacheBy
Atlas Antibodies Anti-PANK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PANK2 Antibody

상품 한눈에 보기

사람 PANK2 단백질에 대한 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 재조합 발현 검증 완료. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 신뢰성 제공. 인간 및 설치류 종에 반응.

카탈로그번호
HPA008440-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008440-100 Anti-PANK2 Antibody, pantothenate kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008440-25 Anti-PANK2 Antibody, pantothenate kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PANK2 Antibody

Anti-PANK2 Antibody

Target: pantothenate kinase 2 (PANK2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PANK2.


Alternative Gene Names

C20orf48, FLJ11729, HARP, HSS, NBIA1, PKAN

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein pantothenate kinase 2
Target Gene PANK2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000025286 (98%)
  • Mouse ENSMUSG00000037514 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.