
Atlas Antibodies Anti-P4HA1 Antibody
상품 한눈에 보기
Human P4HA1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인체 단백질 발현 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-P4HA1 Antibody
Target: prolyl 4-hydroxylase, alpha polypeptide I
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – independent antibody validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human P4HA1
Alternative Gene Names
C-P4Halpha(I), P4HA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | prolyl 4-hydroxylase, alpha polypeptide I |
| Target Gene | P4HA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000019916 (97%), Rat ENSRNOG00000050655 (97%) |
Antigen Sequence:
FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDC
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-P4HA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-P4HA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-P4HA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-P4HA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-P4HA2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.