CacheBy
Atlas Antibodies Anti-P4HA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-P4HA1 Antibody

상품 한눈에 보기

Human P4HA1 단백질을 타깃으로 하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제됨. 토끼 유래 IgG 형식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026593-100 Anti-P4HA1 Antibody, prolyl 4-hydroxylase, alpha polypeptide I 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026593-25 Anti-P4HA1 Antibody, prolyl 4-hydroxylase, alpha polypeptide I 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-P4HA1 Antibody

Anti-P4HA1 Antibody

Target Protein: prolyl 4-hydroxylase, alpha polypeptide I
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Independent validation using antibodies targeting different epitopes
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human P4HA1.

Alternative Gene Names

C-P4Halpha(I), P4HA

Open Datasheet (PDF)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDC

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000019916 97%
Rat ENSRNOG00000050655 97%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.