CacheBy
Atlas Antibodies Anti-OSBPL5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OSBPL5 Antibody

상품 한눈에 보기

Human OSBPL5 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, 고순도와 높은 특이성을 제공. 40% glycerol 기반 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038712-100 Anti-OSBPL5 Antibody, oxysterol binding protein-like 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038712-25 Anti-OSBPL5 Antibody, oxysterol binding protein-like 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OSBPL5 Antibody

Anti-OSBPL5 Antibody

Target: oxysterol binding protein-like 5 (OSBPL5)
Supplier: Atlas Antibodies


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human OSBPL5 (oxysterol binding protein-like 5).


Alternative Gene Names

  • KIAA1534
  • ORP5

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
LCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEEL


Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000020713 80%
Mouse ENSMUSG00000037606 80%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.