
Atlas Antibodies Anti-OSBPL5 Antibody
Human OSBPL5 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, 고순도와 높은 특이성을 제공. 40% glycerol 기반 버퍼에 보존제 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-OSBPL5 Antibody
Target: oxysterol binding protein-like 5 (OSBPL5)
Supplier: Atlas Antibodies
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human OSBPL5 (oxysterol binding protein-like 5).
Alternative Gene Names
- KIAA1534
- ORP5
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
LCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEEL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000020713 | 80% |
| Mouse | ENSMUSG00000037606 | 80% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-OSBPL7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-OSBPL6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-OSBPL5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-OSBPL5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-OSBPL3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|