Atlas Antibodies Anti-OSBPL6 Antibody

상품 한눈에 보기

인간 OSBPL6 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 토끼 유래 IgG 형태입니다. RNA-seq 데이터 기반의 정교한 Orthogonal 검증을 거친 고품질 연구용 항체입니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA032131-100 Anti-OSBPL6 Antibody, oxysterol binding protein-like 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA032131-25 Anti-OSBPL6 Antibody, oxysterol binding protein-like 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-OSBPL6 Antibody

Anti-OSBPL6 Antibody

Target: oxysterol binding protein-like 6
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human OSBPL6

Alternative Gene Names

ORP6

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	oxysterol binding protein-like 6
Target Gene	OSBPL6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	NEIVRSPRDASFHIFPSTSTAESSPAANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVE
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000042359 (98%), Rat ENSRNOG00000010812 (97%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand