Thermo Fisher Scientific Cytochrome P450 Reductase Polyclonal Antibody
Cytochrome P450 Reductase를 인식하는 Rabbit Polyclonal Antibody로, Human, Mouse, Rat 시료에 반응합니다. WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 -20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human POR (633–668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746963 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which enable electron transfer directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been linked to disorders such as combined P450C17 and P450C21 deficiency, amenorrhea, disordered steroidogenesis, congenital adrenal hyperplasia, and Antley-Bixler syndrome.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PON1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PON1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Cytochrome P450 Reductase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific POLB Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PNP Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|