
Atlas Antibodies Anti-OOEP Antibody
상품 한눈에 보기
Human OOEP 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합. Affinity purification으로 높은 특이성과 재현성 확보. 40% glycerol 기반 완충액에 보존. Human에 대해 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-OOEP Antibody
Target: oocyte expressed protein (OOEP)
Type: Polyclonal Antibody against Human OOEP
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
This polyclonal antibody is raised in rabbit against the human oocyte expressed protein (OOEP). It is affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
C6orf156, Em:AC019205.2, KHDC2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | oocyte expressed protein |
| Target Gene | OOEP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASDPHSPQD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000032346 (45%), Rat ENSRNOG00000025957 (43%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
