
원본
Atlas Antibodies Anti-OOEP Antibody
상품 한눈에 보기
Human OOEP 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합. Affinity purification으로 높은 특이성과 재현성 확보. 40% glycerol 기반 완충액에 보존. Human에 대해 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055165-100 Anti-OOEP Antibody, oocyte expressed protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055165-25 Anti-OOEP Antibody, oocyte expressed protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-OOEP Antibody
Anti-OOEP Antibody
Target: oocyte expressed protein (OOEP)
Type: Polyclonal Antibody against Human OOEP
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
This polyclonal antibody is raised in rabbit against the human oocyte expressed protein (OOEP). It is affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
C6orf156, Em:AC019205.2, KHDC2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | oocyte expressed protein |
| Target Gene | OOEP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASDPHSPQD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000032346 (45%), Rat ENSRNOG00000025957 (43%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



