CacheBy
Atlas Antibodies Anti-OPA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OPA1 Antibody

상품 한눈에 보기

사람 OPA1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 토끼에서 생산되었으며, 고순도의 Affinity purification 방식으로 정제되었습니다. 인간에 특이적으로 반응하며 안정적인 PBS/glycerol buffer에 보관됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036926-100 Anti-OPA1 Antibody, optic atrophy 1 (autosomal dominant) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036926-25 Anti-OPA1 Antibody, optic atrophy 1 (autosomal dominant) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OPA1 Antibody

Anti-OPA1 Antibody

Target: optic atrophy 1 (autosomal dominant)
Type: Polyclonal Antibody against Human OPA1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody targeting human OPA1, a mitochondrial dynamin-like GTPase involved in inner membrane fusion and maintenance of mitochondrial morphology.


Alternative Gene Names

FLJ12460, KIAA0567, MGM1, NPG, NTG

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein optic atrophy 1 (autosomal dominant)
Target Gene OPA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNE
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000001717 (95%), Mouse ENSMUSG00000038084 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.