
Atlas Antibodies Anti-OMD Antibody
상품 한눈에 보기
Human OMD(osteomodulin)을 인식하는 Rabbit Polyclonal Antibody. Affinity purification으로 높은 특이성과 재현성을 제공. Human에 검증됨. ICC 등 연구용 응용에 적합. 40% glycerol/PBS buffer로 안정화.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-OMD Antibody
Target Information
- Target Protein: osteomodulin
- Target Gene: OMD
- Alternative Gene Names: osteoadherin, SLRR2C
Product Description
Polyclonal antibody against human osteomodulin (OMD).
Recommended for research applications such as immunocytochemistry (ICC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP
Species Reactivity
- Verified Species: Human
- Ortholog Identity:
- Rat ENSRNOG00000039560 (86%)
- Mouse ENSMUSG00000048368 (85%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 실험 목적에 따라 사용자가 직접 결정해야 합니다.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
