CacheBy
Atlas Antibodies Anti-OMD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OMD Antibody

상품 한눈에 보기

Human OMD(osteomodulin)을 인식하는 Rabbit Polyclonal Antibody. Affinity purification으로 높은 특이성과 재현성을 제공. Human에 검증됨. ICC 등 연구용 응용에 적합. 40% glycerol/PBS buffer로 안정화.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069948-100 Anti-OMD Antibody, osteomodulin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069948-25 Anti-OMD Antibody, osteomodulin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OMD Antibody

Anti-OMD Antibody

Target Information

  • Target Protein: osteomodulin
  • Target Gene: OMD
  • Alternative Gene Names: osteoadherin, SLRR2C

Product Description

Polyclonal antibody against human osteomodulin (OMD).
Recommended for research applications such as immunocytochemistry (ICC).

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP

Species Reactivity

  • Verified Species: Human
  • Ortholog Identity:
    • Rat ENSRNOG00000039560 (86%)
    • Mouse ENSMUSG00000048368 (85%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 실험 목적에 따라 사용자가 직접 결정해야 합니다.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.