CacheBy
Atlas Antibodies Anti-OMG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OMG Antibody

상품 한눈에 보기

인간 OMG 단백질을 타겟으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합. 토끼 유래 IgG 항체이며, 친화성 정제 방식으로 높은 특이성과 안정성을 제공. 인체 반응성이 검증되어 신경계 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012693-100 Anti-OMG Antibody, oligodendrocyte myelin glycoprotein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012693-25 Anti-OMG Antibody, oligodendrocyte myelin glycoprotein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OMG Antibody

Anti-OMG Antibody

Target: oligodendrocyte myelin glycoprotein (OMG)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human OMG.


Alternative Gene Names

  • OMGP

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein oligodendrocyte myelin glycoprotein
Target Gene OMG
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVANAWKVNA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000014107 81%
Mouse ENSMUSG00000049612 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.