
Atlas Antibodies Anti-ODF3L2 Antibody
상품 한눈에 보기
인간 ODF3L2 단백질을 표적으로 하는 폴리클로날 항체로, 토끼에서 생산된 IgG 형식입니다. 면역세포화학 등 다양한 연구용으로 사용 가능하며, PrEST 항원으로 친화 정제되었습니다. 인간에 높은 반응성을 보이며, 글리세롤 및 PBS 완충액에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ODF3L2 Antibody
Target: Outer dense fiber of sperm tails 3 like 2 (ODF3L2)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human ODF3L2.
Alternative Gene Names
C19orf19, FLJ40059
Recommended Applications
- Immunocytochemistry (ICC)
- Other research applications as validated by user
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Outer dense fiber of sperm tails 3 like 2 |
| Target Gene | ODF3L2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (83%), Rat (81%) |
Antigen Sequence
EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
