CacheBy
Atlas Antibodies Anti-ODF3L2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ODF3L2 Antibody

상품 한눈에 보기

인간 ODF3L2 단백질을 표적으로 하는 폴리클로날 항체로, 토끼에서 생산된 IgG 형식입니다. 면역세포화학 등 다양한 연구용으로 사용 가능하며, PrEST 항원으로 친화 정제되었습니다. 인간에 높은 반응성을 보이며, 글리세롤 및 PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067065-100 Anti-ODF3L2 Antibody, outer dense fiber of sperm tails 3 like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067065-25 Anti-ODF3L2 Antibody, outer dense fiber of sperm tails 3 like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ODF3L2 Antibody

Anti-ODF3L2 Antibody

Target: Outer dense fiber of sperm tails 3 like 2 (ODF3L2)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human ODF3L2.

Alternative Gene Names

C19orf19, FLJ40059

  • Immunocytochemistry (ICC)
  • Other research applications as validated by user

Target Information

항목 내용
Target Protein Outer dense fiber of sperm tails 3 like 2
Target Gene ODF3L2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (83%), Rat (81%)

Antigen Sequence

EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents


제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.