AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ODF2 Antibody
상품 한눈에 보기
휴먼 ODF2 단백질을 인식하는 폴리클로날 항체로, 정자 꼬리 외부 치밀 섬유 단백질 연구에 적합합니다. IHC를 통한 단백질 발현 정교 검증에 사용되며, 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001874-100 Anti-ODF2 Antibody, outer dense fiber of sperm tails 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001874-25 Anti-ODF2 Antibody, outer dense fiber of sperm tails 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ODF2 Antibody
Anti-ODF2 Antibody
Target: Outer dense fiber of sperm tails 2 (ODF2)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human ODF2.
Alternative Gene Names
CT134, ODF84
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Outer dense fiber of sperm tails 2 |
| Target Gene | ODF2 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Ortholog Identity | Rat ENSRNOG00000014584 (99%), Mouse ENSMUSG00000026790 (99%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.