
Atlas Antibodies Anti-NUMA1 Antibody
상품 한눈에 보기
Human NUMA1 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립적·유전적 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human, Rat, Mouse 간 교차 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NUMA1 Antibody
Target: Nuclear mitotic apparatus protein 1 (NUMA1)
Type: Rabbit Polyclonal Antibody
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation in Western blot by siRNA knockdown.
- ICC (Immunocytochemistry): Suitable for immunocytochemical analysis.
Product Description
Polyclonal antibody against human NUMA1.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Nuclear mitotic apparatus protein 1 |
| Target Gene | NUMA1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | IRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKEL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000000417 (87%), Mouse ENSMUSG00000066306 (87%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Information | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NUMA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP133 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUMA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUFIP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUF2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.