
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NUMA1 Antibody
상품 한눈에 보기
Human NUMA1 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립적·유전적 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human, Rat, Mouse 간 교차 반응성 확인.
- 카탈로그번호
- HPA019859-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019859-100 Anti-NUMA1 Antibody, nuclear mitotic apparatus protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019859-25 Anti-NUMA1 Antibody, nuclear mitotic apparatus protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NUMA1 Antibody
Anti-NUMA1 Antibody
Target: Nuclear mitotic apparatus protein 1 (NUMA1)
Type: Rabbit Polyclonal Antibody
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation in Western blot by siRNA knockdown.
- ICC (Immunocytochemistry): Suitable for immunocytochemical analysis.
Product Description
Polyclonal antibody against human NUMA1.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Nuclear mitotic apparatus protein 1 |
| Target Gene | NUMA1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | IRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKEL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000000417 (87%), Mouse ENSMUSG00000066306 (87%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Information | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



