
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NUMA1 Antibody
상품 한눈에 보기
Human NUMA1 단백질을 표적으로 하는 rabbit polyclonal antibody. IHC, WB, ICC 등 다양한 응용에 적합. siRNA knockdown 및 독립 항체 비교를 통한 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA019841-100 Anti-NUMA1 Antibody, nuclear mitotic apparatus protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019841-25 Anti-NUMA1 Antibody, nuclear mitotic apparatus protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NUMA1 Antibody
Anti-NUMA1 Antibody
Target: Nuclear mitotic apparatus protein 1 (NUMA1)
Type: Rabbit Polyclonal Antibody
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic validation): Genetic validation in WB by siRNA knockdown.
- ICC: Suitable for immunocytochemistry.
Product Description
Polyclonal antibody against human NUMA1.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Nuclear mitotic apparatus protein 1 |
| Target Gene | NUMA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (87%), Mouse (87%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
IRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



