
Atlas Antibodies Anti-NUDT6 Antibody
상품 한눈에 보기
Human NUDT6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB(재조합 발현 검증), ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간 반응성이 검증되었습니다. 다양한 종에서 높은 상동성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NUDT6 Antibody
nudix (nucleoside diphosphate linked moiety X)-type motif 6
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Recombinant expression validation using target protein overexpression
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human NUDT6.
Alternative Gene Names
FGF-AS, FGF2AS, gfg, gfg-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nudix (nucleoside diphosphate linked moiety X)-type motif 6 |
| Target Gene | NUDT6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KSEFRSVLSIRQQHTNPGAFGKSDMYIICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFDKIDLTVEELPAVYTGLF |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000017420 (83%), Mouse ENSMUSG00000050174 (81%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NUFIP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUDT6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUDT8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUDT6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.