CacheBy
Atlas Antibodies Anti-NUDT6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUDT6 Antibody

상품 한눈에 보기

Human NUDT6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 재조합 발현 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039202-100 Anti-NUDT6 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039202-25 Anti-NUDT6 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUDT6 Antibody

Anti-NUDT6 Antibody

nudix (nucleoside diphosphate linked moiety X)-type motif 6

  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human NUDT6

Alternative Gene Names

FGF-AS, FGF2AS, gfg, gfg-1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein nudix (nucleoside diphosphate linked moiety X)-type motif 6
Target Gene NUDT6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KSEFRSVLSIRQQHTNPGAFGKSDMYIICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFDKIDLTVEELPAVYTGLF

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000017420 (83%)
  • Mouse ENSMUSG00000050174 (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.