CacheBy
Atlas Antibodies Anti-NTS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NTS Antibody

상품 한눈에 보기

인간 NTS(neurotensin)를 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석에 적합합니다. RNA-seq 데이터와의 정합을 통한 정교한 Orthogonal 검증을 거쳤으며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 PBS 완충액에 보존됩니다.

카탈로그번호
HPA026664-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026664-100 Anti-NTS Antibody, neurotensin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026664-25 Anti-NTS Antibody, neurotensin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NTS Antibody

Anti-NTS Antibody

Target Information

  • Target Protein: neurotensin
  • Target Gene: NTS
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    DFLTNMHTSKLIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRP

Product Description

Polyclonal antibody against human NTS (neurotensin).
Validated for use in immunohistochemistry (IHC) with orthogonal validation comparing protein expression to RNA-seq data in tissues of high and low expression.

Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000019890 (72%), Rat ENSRNOG00000004179 (70%)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Store at recommended conditions. Mix gently before use.
Notes Optimal concentrations and conditions for each application should be determined by the user.

Validation

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Material Safety Data Sheet (Sodium Azide)

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.