Atlas Antibodies Anti-NTS Antibody
상품 한눈에 보기
인간 NTS(neurotensin)를 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석에 적합합니다. RNA-seq 데이터와의 정합을 통한 정교한 Orthogonal 검증을 거쳤으며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 PBS 완충액에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NTS Antibody
Target Information
- Target Protein: neurotensin
- Target Gene: NTS
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DFLTNMHTSKLIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRP
Product Description
Polyclonal antibody against human NTS (neurotensin).
Validated for use in immunohistochemistry (IHC) with orthogonal validation comparing protein expression to RNA-seq data in tissues of high and low expression.
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000019890 (72%), Rat ENSRNOG00000004179 (70%) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage | Store at recommended conditions. Mix gently before use. |
| Notes | Optimal concentrations and conditions for each application should be determined by the user. |
Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Material Safety Data Sheet (Sodium Azide)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.