AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NTNG2 Antibody
상품 한눈에 보기
Human NTNG2 단백질을 인식하는 Rabbit Polyclonal 항체로, netrin G2 단백질 연구에 적합. Affinity purified 방식으로 높은 특이성과 재현성 제공. Human에서 검증되었으며, PBS/glycerol buffer에 보존.
- 카탈로그번호
- HPA071290-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA071290-100 Anti-NTNG2 Antibody, netrin G2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071290-25 Anti-NTNG2 Antibody, netrin G2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NTNG2 Antibody
Anti-NTNG2 Antibody
Target Information
- Target Protein: netrin G2
- Target Gene: NTNG2
- Alternative Gene Names: KIAA1857, Lmnt2, NTNG1
Product Description
Polyclonal antibody against Human NTNG2, produced in rabbit. Suitable for applications involving detection of netrin G2.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
DYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGD
Verified Species Reactivity
- Human
Interspecies Sequence Identity
| Species | Ortholog ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000013694 | 100% |
| Mouse | ENSMUSG00000035513 | 100% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Recommended Applications
ICC (Immunocytochemistry)
Notes
Gently mix before use. Optimal concentrations and experimental conditions should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.