
Atlas Antibodies Anti-NTNG2 Antibody
상품 한눈에 보기
Human NTNG2 단백질을 인식하는 Rabbit Polyclonal 항체로, netrin G2 단백질 연구에 적합. Affinity purified 방식으로 높은 특이성과 재현성 제공. Human에서 검증되었으며, PBS/glycerol buffer에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NTNG2 Antibody
Target Information
- Target Protein: netrin G2
- Target Gene: NTNG2
- Alternative Gene Names: KIAA1857, Lmnt2, NTNG1
Product Description
Polyclonal antibody against Human NTNG2, produced in rabbit. Suitable for applications involving detection of netrin G2.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
DYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGD
Verified Species Reactivity
- Human
Interspecies Sequence Identity
| Species | Ortholog ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000013694 | 100% |
| Mouse | ENSMUSG00000035513 | 100% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Recommended Applications
ICC (Immunocytochemistry)
Notes
Gently mix before use. Optimal concentrations and experimental conditions should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
