CacheBy
Atlas Antibodies Anti-NT5E Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NT5E Antibody

상품 한눈에 보기

휴먼 NT5E(CD73)에 특이적인 폴리클로날 항체로 IHC, WB, ICC에 적합합니다. 토끼에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 PBS 버퍼에 보존되어 있으며, 인간에 대해 검증된 반응성을 가집니다.

카탈로그번호
HPA017357-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017357-100 Anti-NT5E Antibody, 5`-nucleotidase, ecto (CD73) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017357-25 Anti-NT5E Antibody, 5`-nucleotidase, ecto (CD73) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NT5E Antibody

Anti-NT5E Antibody

Target Information

  • Target Protein: 5'-nucleotidase, ecto (CD73)
  • Target Gene: NT5E
  • Alternative Gene Names: CALJA, CD73, eN, eNT, NT5

Product Description

Polyclonal antibody against human NT5E.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000011071 92%
Mouse ENSMUSG00000032420 90%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.