
Atlas Antibodies Anti-NT5E Antibody
상품 한눈에 보기
휴먼 NT5E(CD73)에 특이적인 폴리클로날 항체로 IHC, WB, ICC에 적합합니다. 토끼에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 PBS 버퍼에 보존되어 있으며, 인간에 대해 검증된 반응성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NT5E Antibody
Target Information
- Target Protein: 5'-nucleotidase, ecto (CD73)
- Target Gene: NT5E
- Alternative Gene Names: CALJA, CD73, eN, eNT, NT5
Product Description
Polyclonal antibody against human NT5E.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000011071 | 92% |
| Mouse | ENSMUSG00000032420 | 90% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet
Open Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NTNG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NTNG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NT5E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NTMT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NT5DC2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.