Atlas Antibodies Anti-NSDHL Antibody
인간 NSDHL 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, Orthogonal 및 Independent validation으로 신뢰성 검증 완료. 토끼 유래 IgG 항체로 PrEST 항원 기반 친화 정제 제품.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NSDHL Antibody
NAD(P) dependent steroid dehydrogenase-like
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC Application
Suitable for immunocytochemistry (ICC) experiments.
Product Description
Polyclonal Antibody against Human NSDHL
Alternative Gene Names
H105e3, SDR31E1, XAP104
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NAD(P) dependent steroid dehydrogenase-like |
| Target Gene | NSDHL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000031349 (72%), Rat ENSRNOG00000057814 (68%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPSSNNKELFYRVNYIGT제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|