CacheBy
Atlas Antibodies Anti-NSFL1C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NSFL1C Antibody

상품 한눈에 보기

Human NSFL1C 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 검증으로 신뢰성 향상. PrEST 항원을 이용한 친화 정제 제품.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA050628-100 Anti-NSFL1C Antibody, NSFL1 (p97) cofactor (p47) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050628-25 Anti-NSFL1C Antibody, NSFL1 (p97) cofactor (p47) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NSFL1C Antibody

Anti-NSFL1C Antibody

NSFL1 (p97) cofactor (p47)

  • IHC (Immunohistochemistry): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human NSFL1C

Alternative Gene Names

dJ776F14.1, p47, UBX1, UBXD10, UBXN2C

Open Datasheet

Target Information

항목 내용
Target Protein NSFL1 (p97) cofactor (p47)
Target Gene NSFL1C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDNRVTSFRDLIHDQDADEE
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000008604 (95%), Mouse ENSMUSG00000027455 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.