
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NSFL1C Antibody
상품 한눈에 보기
Human NSFL1C 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 검증을 통해 높은 신뢰도의 단백질 발현 검증 제공. PrEST 항원을 이용해 친화 정제된 고품질 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA047108-100 Anti-NSFL1C Antibody, NSFL1 (p97) cofactor (p47) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047108-25 Anti-NSFL1C Antibody, NSFL1 (p97) cofactor (p47) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NSFL1C Antibody
Anti-NSFL1C Antibody
NSFL1 (p97) cofactor (p47)
Recommended Applications
IHC (Independent validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Independent validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC
Product Description
Polyclonal antibody against Human NSFL1C.
Alternative Gene Names
dJ776F14.1, p47, UBX1, UBXD10, UBXN2C
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NSFL1 (p97) cofactor (p47) |
| Target Gene | NSFL1C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDNRVTSFRDLIHDQDADEE |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000008604 (95%), Mouse ENSMUSG00000027455 (94%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



