CacheBy
Atlas Antibodies Anti-NSL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NSL1 Antibody

상품 한눈에 보기

인간 NSL1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합합니다. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA045761-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045761-100 Anti-NSL1 Antibody, NSL1, MIS12 kinetochore complex component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045761-25 Anti-NSL1 Antibody, NSL1, MIS12 kinetochore complex component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NSL1 Antibody

Anti-NSL1 Antibody

NSL1, MIS12 kinetochore complex component


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human NSL1


Alternative Gene Names

C1orf48, DC8, DKFZP566O1646, MIS14

Open Datasheet


Target Information

항목 내용
Target Protein NSL1, MIS12 kinetochore complex component
Target Gene NSL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000042286 (79%), Mouse ENSMUSG00000062510 (76%)

Antigen Sequence:

FVQKLGDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYP

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.