CacheBy
Atlas Antibodies Anti-NRIP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NRIP1 Antibody

상품 한눈에 보기

인간 NRIP1(nuclear receptor interacting protein 1)에 대한 고특이성 폴리클로날 항체. Rabbit 유래 IgG 형식으로 제작되어 다양한 응용(ICC 등)에 적합. Affinity purification으로 높은 순도 확보. Human에 반응하며 Rat, Mouse와도 높은 서열 유사성 보유. 40% glycerol/PBS buffer, sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA060036-100 Anti-NRIP1 Antibody, nuclear receptor interacting protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060036-25 Anti-NRIP1 Antibody, nuclear receptor interacting protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NRIP1 Antibody

Anti-NRIP1 Antibody

Target Information

  • Target Protein: Nuclear receptor interacting protein 1
  • Target Gene: NRIP1
  • Alternative Gene Names: RIP140

Product Description

Polyclonal antibody against human NRIP1.

이미지 내 텍스트(OCR): ICC (Immunocytochemistry)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000001585 80%
Mouse ENSMUSG00000048490 79%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Usage Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.