Atlas Antibodies Anti-NRIP1 Antibody
상품 한눈에 보기
인간 NRIP1(nuclear receptor interacting protein 1)에 대한 고특이성 폴리클로날 항체. Rabbit 유래 IgG 형식으로 제작되어 다양한 응용(ICC 등)에 적합. Affinity purification으로 높은 순도 확보. Human에 반응하며 Rat, Mouse와도 높은 서열 유사성 보유. 40% glycerol/PBS buffer, sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NRIP1 Antibody
Target Information
- Target Protein: Nuclear receptor interacting protein 1
- Target Gene: NRIP1
- Alternative Gene Names: RIP140
Product Description
Polyclonal antibody against human NRIP1.
Recommended Applications
이미지 내 텍스트(OCR): ICC (Immunocytochemistry)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000001585 | 80% |
| Mouse | ENSMUSG00000048490 | 79% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Usage Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.