CacheBy
Atlas Antibodies Anti-NRIP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NRIP1 Antibody

상품 한눈에 보기

Human NRIP1 단백질을 인식하는 Rabbit Polyclonal 항체로, 핵 수용체 상호작용 단백질 연구에 적합. Affinity purified 방식으로 정제되었으며, ICC 등 다양한 응용에 사용 가능. Human에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046571-100 Anti-NRIP1 Antibody, nuclear receptor interacting protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046571-25 Anti-NRIP1 Antibody, nuclear receptor interacting protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NRIP1 Antibody

Anti-NRIP1 Antibody

Target: Nuclear receptor interacting protein 1 (NRIP1)
Type: Polyclonal Antibody against Human NRIP1


면역세포화학(ICC) 등 다양한 응용에 적합

(이미지 내 텍스트: "ICC")


Product Description

Polyclonal antibody produced in rabbit, targeting human NRIP1.


Alternative Gene Names

  • RIP140

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Nuclear receptor interacting protein 1
Target Gene NRIP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000001585 (80%), Mouse ENSMUSG00000048490 (79%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.