CacheBy
Atlas Antibodies Anti-NRBP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NRBP1 Antibody

상품 한눈에 보기

Human NRBP1 단백질을 인식하는 폴리클로날 항체. IHC 및 WB(재조합 발현) 검증 완료. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용한 친화 정제. Human 반응성 확인 및 높은 종간 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA029527-100 Anti-NRBP1 Antibody, nuclear receptor binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029527-25 Anti-NRBP1 Antibody, nuclear receptor binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NRBP1 Antibody

Anti-NRBP1 Antibody

Target: nuclear receptor binding protein 1 (NRBP1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – validated using recombinant expression
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against Human NRBP1.


Alternative Gene Names

BCON3, MADM, MUDPNP, NRBP

Open Datasheet


Target Information

항목 내용
Target Protein nuclear receptor binding protein 1
Target Gene NRBP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence STTSAASPEEEEESEDESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADIKENKARVIFITEYMSSGSLKQFLKKT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000050570): 99%
  • Mouse (ENSMUSG00000029148): 99%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.