
Atlas Antibodies Anti-NR2C2AP Antibody
상품 한눈에 보기
Human NR2C2AP 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Recombinant expression을 통한 검증 완료. Rabbit 유래 IgG로, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응성을 보이며, TRA16으로도 알려져 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NR2C2AP Antibody
Target: nuclear receptor 2C2-associated protein (NR2C2AP)
Type: Polyclonal Antibody against Human NR2C2AP
Alternative Gene Name: TRA16
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against Human NR2C2AP, validated for IHC and WB applications.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nuclear receptor 2C2-associated protein |
| Target Gene | NR2C2AP |
| Alternative Gene Name | TRA16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000071078 (80%), Rat ENSRNOG00000002320 (28%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NRARP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NRBF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR2C2AP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR4A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR2C2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.