
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NR2C2AP Antibody
상품 한눈에 보기
Human NR2C2AP 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Recombinant expression을 통한 검증 완료. Rabbit 유래 IgG로, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응성을 보이며, TRA16으로도 알려져 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA055653-100 Anti-NR2C2AP Antibody, nuclear receptor 2C2-associated protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055653-25 Anti-NR2C2AP Antibody, nuclear receptor 2C2-associated protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NR2C2AP Antibody
Anti-NR2C2AP Antibody
Target: nuclear receptor 2C2-associated protein (NR2C2AP)
Type: Polyclonal Antibody against Human NR2C2AP
Alternative Gene Name: TRA16
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against Human NR2C2AP, validated for IHC and WB applications.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nuclear receptor 2C2-associated protein |
| Target Gene | NR2C2AP |
| Alternative Gene Name | TRA16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000071078 (80%), Rat ENSRNOG00000002320 (28%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



