CacheBy
Atlas Antibodies Anti-NR2C2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NR2C2 Antibody

상품 한눈에 보기

Human NR2C2 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 Affinity Purified 되었으며 Human, Mouse, Rat에 반응합니다. 40% glycerol/PBS buffer로 안정적으로 보관 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA006313-100 Anti-NR2C2 Antibody, nuclear receptor subfamily 2, group C, member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006313-25 Anti-NR2C2 Antibody, nuclear receptor subfamily 2, group C, member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NR2C2 Antibody

Anti-NR2C2 Antibody

Target: nuclear receptor subfamily 2, group C, member 2 (NR2C2)
Type: Polyclonal Antibody against Human NR2C2


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human NR2C2.


Alternative Gene Names

hTAK1, TAK1, TR2R1, TR4

Open Datasheet


Target Information

항목 내용
Target Protein nuclear receptor subfamily 2, group C, member 2
Target Gene NR2C2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Homology Rat ENSRNOG00000010536 (96%), Mouse ENSMUSG00000005893 (96%)

Antigen Sequence:
DGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMP


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.