
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NR4A1 Antibody
상품 한눈에 보기
Human NR4A1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA070142-100 Anti-NR4A1 Antibody, nuclear receptor subfamily 4 group A member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070142-25 Anti-NR4A1 Antibody, nuclear receptor subfamily 4 group A member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NR4A1 Antibody
Anti-NR4A1 Antibody
Target: nuclear receptor subfamily 4, group A, member 1 (NR4A1)
Type: Polyclonal Antibody against Human NR4A1
Recommended Applications
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against Human NR4A1.
Alternative Gene Names
GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nuclear receptor subfamily 4, group A, member 1 |
| Target Gene | NR4A1 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007607 (92%), Mouse ENSMUSG00000023034 (91%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



