CacheBy
Atlas Antibodies Anti-NR4A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NR4A1 Antibody

상품 한눈에 보기

Human NR4A1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA070142-100 Anti-NR4A1 Antibody, nuclear receptor subfamily 4 group A member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070142-25 Anti-NR4A1 Antibody, nuclear receptor subfamily 4 group A member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NR4A1 Antibody

Anti-NR4A1 Antibody

Target: nuclear receptor subfamily 4, group A, member 1 (NR4A1)
Type: Polyclonal Antibody against Human NR4A1


  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against Human NR4A1.


Alternative Gene Names

GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3


Target Information

항목 내용
Target Protein nuclear receptor subfamily 4, group A, member 1
Target Gene NR4A1
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000007607 (92%), Mouse ENSMUSG00000023034 (91%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
WB Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.