
Atlas Antibodies Anti-NR4A1 Antibody
Human NR4A1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NR4A1 Antibody
Target: nuclear receptor subfamily 4, group A, member 1 (NR4A1)
Type: Polyclonal Antibody against Human NR4A1
Recommended Applications
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against Human NR4A1.
Alternative Gene Names
GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nuclear receptor subfamily 4, group A, member 1 |
| Target Gene | NR4A1 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007607 (92%), Mouse ENSMUSG00000023034 (91%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NR2C2AP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR3C1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR4A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR3C2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR2E1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|