Atlas Antibodies Anti-NR4A1 Antibody

상품 한눈에 보기

Human NR4A1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA070142-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA070142-100 Anti-NR4A1 Antibody, nuclear receptor subfamily 4 group A member 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA070142-25 Anti-NR4A1 Antibody, nuclear receptor subfamily 4 group A member 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NR4A1 Antibody

Anti-NR4A1 Antibody

Target: nuclear receptor subfamily 4, group A, member 1 (NR4A1)
Type: Polyclonal Antibody against Human NR4A1

Recommended Applications

WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against Human NR4A1.

Alternative Gene Names

GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3

Target Information

항목	내용
Target Protein	nuclear receptor subfamily 4, group A, member 1
Target Gene	NR4A1
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000007607 (92%), Mouse ENSMUSG00000023034 (91%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG