Atlas Antibodies Anti-NR3C1 Antibody

상품 한눈에 보기

Human NR3C1(Glucocorticoid receptor) 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태. WB 및 ICC 등 다양한 응용에 적합하며, PrEST 항원 기반 정제. 인간에 반응하며 Orthogonal validation을 통해 단백질 발현 검증.

카탈로그번호: HPA004248-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004248-100 Anti-NR3C1 Antibody, nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004248-25 Anti-NR3C1 Antibody, nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NR3C1 Antibody

Anti-NR3C1 Antibody

Target: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human NR3C1

Alternative Gene Names

GR, GRL

Open Datasheet

Antigen Information

Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000024431	72%
Rat	ENSRNOG00000048800	71%

Antibody Specifications

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand