
1 / 2
Atlas Antibodies Anti-NR3C1 Antibody
상품 한눈에 보기
Human NR3C1(Glucocorticoid receptor) 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태. WB 및 ICC 등 다양한 응용에 적합하며, PrEST 항원 기반 정제. 인간에 반응하며 Orthogonal validation을 통해 단백질 발현 검증.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NR3C1 Antibody
Target: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human NR3C1
Alternative Gene Names
GR, GRL
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024431 | 72% |
| Rat | ENSRNOG00000048800 | 71% |
Antibody Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NR2C2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR2C2AP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR3C1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR4A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NR3C2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.