
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NR3C1 Antibody
상품 한눈에 보기
Human NR3C1(Glucocorticoid receptor) 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태. WB 및 ICC 등 다양한 응용에 적합하며, PrEST 항원 기반 정제. 인간에 반응하며 Orthogonal validation을 통해 단백질 발현 검증.
- 카탈로그번호
- HPA004248-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA004248-100 Anti-NR3C1 Antibody, nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004248-25 Anti-NR3C1 Antibody, nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NR3C1 Antibody
Anti-NR3C1 Antibody
Target: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human NR3C1
Alternative Gene Names
GR, GRL
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024431 | 72% |
| Rat | ENSRNOG00000048800 | 71% |
Antibody Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



