CacheBy
Atlas Antibodies Anti-NR3C1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NR3C1 Antibody

상품 한눈에 보기

Human NR3C1(Glucocorticoid receptor) 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태. WB 및 ICC 등 다양한 응용에 적합하며, PrEST 항원 기반 정제. 인간에 반응하며 Orthogonal validation을 통해 단백질 발현 검증.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA004248-100 Anti-NR3C1 Antibody, nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004248-25 Anti-NR3C1 Antibody, nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NR3C1 Antibody

Anti-NR3C1 Antibody

Target: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human NR3C1


Alternative Gene Names

GR, GRL

Open Datasheet


Antigen Information

  • Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000024431 72%
Rat ENSRNOG00000048800 71%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.