원본

Atlas Antibodies Anti-NPPA Antibody

상품 한눈에 보기

인체 NPPA 단백질을 표적으로 하는 폴리클로날 항체. IHC를 통한 단백질 발현의 정교한 Orthogonal 검증에 적합. 토끼 유래 IgG 형식으로 제작되어 높은 특이성과 재현성을 제공. 인간 시료에 검증된 반응성을 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058269-100 Anti-NPPA Antibody, natriuretic peptide A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058269-25 Anti-NPPA Antibody, natriuretic peptide A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Natriuretic Peptide A (NPPA)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human NPPA.

항목	내용
Target Protein	Natriuretic peptide A
Target Gene	NPPA
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000041616 (81%) Rat ENSRNOG00000008176 (78%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

GQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWT

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet (MSDS)

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.