CacheBy
Atlas Antibodies Anti-NPR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPR1 Antibody

상품 한눈에 보기

인간 NPR1 단백질을 인식하는 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화정제되었습니다. 인간 반응성이 검증되었으며, 마우스·랫과 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA031087-100 Anti-NPR1 Antibody, natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031087-25 Anti-NPR1 Antibody, natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPR1 Antibody

Anti-NPR1 Antibody

Target: Natriuretic peptide receptor A / Guanylate cyclase A (atrionatriuretic peptide receptor A)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NPR1

Alternative Gene Names

ANPa, ANPRA, GUCY2A, NPRA

Open Datasheet

Target Information

항목 내용
Target Protein Natriuretic peptide receptor A / Guanylate cyclase A
Target Gene NPR1
Verified Species Reactivity Human
Interspecies Identity Mouse (86%), Rat (84%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Antigen Sequence

FHLDIFGQSLQGGQGPAPRRPWERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENG

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.