
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NPR1 Antibody
상품 한눈에 보기
인간 NPR1 단백질을 인식하는 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화정제되었습니다. 인간 반응성이 검증되었으며, 마우스·랫과 높은 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA031087-100 Anti-NPR1 Antibody, natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031087-25 Anti-NPR1 Antibody, natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NPR1 Antibody
Anti-NPR1 Antibody
Target: Natriuretic peptide receptor A / Guanylate cyclase A (atrionatriuretic peptide receptor A)
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human NPR1
Alternative Gene Names
ANPa, ANPRA, GUCY2A, NPRA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Natriuretic peptide receptor A / Guanylate cyclase A |
| Target Gene | NPR1 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (86%), Rat (84%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Antigen Sequence
FHLDIFGQSLQGGQGPAPRRPWERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENG
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.


