Atlas Antibodies Anti-NPLOC4 Antibody

상품 한눈에 보기

Human NPLOC4 단백질을 표적으로 하는 고품질 폴리클론 항체. IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체로 PrEST 항원 친화 정제. Human, Mouse, Rat 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023295-100 Anti-NPLOC4 Antibody, nuclear protein localization 4 homolog (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023295-25 Anti-NPLOC4 Antibody, nuclear protein localization 4 homolog (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: nuclear protein localization 4 homolog (S. cerevisiae)
Supplier: Atlas Antibodies

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human NPLOC4

FLJ20657, KIAA1499, NPL4

항목	내용
Target Protein	nuclear protein localization 4 homolog (S. cerevisiae)
Target Gene	NPLOC4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (AA)	VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000036698 (99%), Mouse ENSMUSG00000039703 (99%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.