CacheBy
Atlas Antibodies Anti-NPLOC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPLOC4 Antibody

상품 한눈에 보기

Human NPLOC4 단백질을 표적으로 하는 고품질 폴리클론 항체. IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체로 PrEST 항원 친화 정제. Human, Mouse, Rat 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA023295-100 Anti-NPLOC4 Antibody, nuclear protein localization 4 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023295-25 Anti-NPLOC4 Antibody, nuclear protein localization 4 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPLOC4 Antibody

Anti-NPLOC4 Antibody

Target: nuclear protein localization 4 homolog (S. cerevisiae)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, independent validation)
  • Immunocytochemistry (ICC)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human NPLOC4


Alternative Gene Names

FLJ20657, KIAA1499, NPL4

Open Datasheet


Target Information

항목 내용
Target Protein nuclear protein localization 4 homolog (S. cerevisiae)
Target Gene NPLOC4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (AA) VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000036698 (99%), Mouse ENSMUSG00000039703 (99%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.