CacheBy
Atlas Antibodies Anti-NPM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPM1 Antibody

상품 한눈에 보기

Human NPM1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤/PBS 버퍼에 보존됩니다. 인간 반응성이 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 보입니다.

카탈로그번호
HPA011384-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011384-100 Anti-NPM1 Antibody, nucleophosmin (nucleolar phosphoprotein B23, numatrin) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011384-25 Anti-NPM1 Antibody, nucleophosmin (nucleolar phosphoprotein B23, numatrin) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPM1 Antibody

Anti-NPM1 Antibody

Target: nucleophosmin (nucleolar phosphoprotein B23, numatrin)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NPM1.


Alternative Gene Names

B23, NPM

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nucleophosmin (nucleolar phosphoprotein B23, numatrin)
Target Gene NPM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000057113) – 86%
  • Rat (ENSRNOG00000004616) – 86%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.