
Atlas Antibodies Anti-NOXO1 Antibody
상품 한눈에 보기
Human NOXO1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, NADPH oxidase organizer 1 연구용에 적합. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 응용에 사용 가능. 40% glycerol 기반 PBS buffer에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NOXO1 Antibody
Target: NADPH oxidase organizer 1 (NOXO1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human NOXO1 (NADPH oxidase organizer 1).
Alternative Gene Names
P41NOXA, P41NOXB, P41NOXC, SH3PXD5, SNX28
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
LLETYSRRLLATAERVARSPTITGFFAPQPLDLE
Species Reactivity
- Verified: Human
- Interspecies Identity:
Species Gene ID Sequence Identity Rat ENSRNOG00000025117 62% Mouse ENSMUSG00000019320 59%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
