
Atlas Antibodies Anti-NPAP1 Antibody
Human NPAP1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 적합. NPAP1 연구 및 핵공 관련 단백질 분석에 유용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NPAP1 Antibody
Target Information
- Target Protein: Nuclear pore associated protein 1
- Target Gene: NPAP1
- Alternative Gene Names: C15orf2
Product Description
Polyclonal antibody against human NPAP1.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
TSVITSKPMNSTSVISTVTTNASAHLTSQTAVDPEVVNMDTTAPSQVVIFTSSLSSRVSSLPNSQIHCSAEQRHPGKTSVYTSPLPFIFHNTTPSFNQLFGKEATPQPKFEAPDGQPQKASLPSA
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000043249 (29%)
- Mouse ENSMUSG00000045672 (27%)
Recommended Applications
Immunohistochemistry (IHC)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NOXO1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NOVA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NPAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NOSIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NOSIP Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|